Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Tesamorelin
Tesamorelin
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Tesamorelin

TSM10
AUD$ 245.00
USD

Tesamorelin (TSM10) is a GHRH analogue research peptide used to study the growth hormone release mechanism and the regulation of the GH/IGF-1 signaling pathway.

Key Specifications

  • Molecular Formula C₂₂₁H₃₆₆N₇₂O₆₇S
  • Molecular Weight 5135.9 Da
  • Purity ≥99%
  • CAS Number 218620-50-9
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 10mg*10 vials

Product Description

Tesamorelin (TSM10) is a synthetic 44-amino acid growth hormone-releasing hormone analog that participates in growth hormone axis-related studies by mimicking the structure of natural GHRH. This peptide has undergone structural optimization to enhance its stability and research application value. Tesamorelin is typically supplied as a white to off-white lyophilized powder, and its quality is assessed by HPLC purity analysis and LC-MS identification. As a research tool, Tesamorelin is primarily used to explore GHRH receptor signaling, growth hormone release regulation, and downstream IGF-1-related biological processes.

Full Specifications

  • Product Name Tesamorelin
  • CAS Number 218620-50-9
  • Molecular Formula C₂₂₁H₃₆₆N₇₂O₆₇S
  • Molecular Weight 5135.9 Da
  • Amino Acid Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Purity (HPLC) ≥99%
  • Appearance White to off-white lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 10mg*10 vials
  • Quality Standards Conform

Research Applications

Tesamorelin is primarily used in endocrinology, growth factor research, and molecular biology. Researchers utilize it to study GHRH receptor activation mechanisms, growth hormone (GH) release regulation, the IGF-1 signaling pathway, and growth hormone axis-related metabolic processes. Furthermore, this research peptide is also used to investigate its mechanisms of action in lipid metabolism, cell signaling, and hormonal regulatory networks.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 5mg+TB 5mg

BPC 5mg+TB 5mgBB10

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of tw...

AUD$142.00 View Details →
BPC 10mg+TB 10mg

BPC 10mg+TB 10mgBB20

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product compose...

AUD$261.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us