Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » BPC 10mg+TB 10mg
BPC 10mg+TB 10mg
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

BPC 10mg+TB 10mg

BB20
AUD$ 261.00
USD

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product composed of two different functional peptides, used for the study of cell repair mechanisms, tissue-related biological processes, and peptide synergy.

Key Specifications

  • Molecular Formula C₆₂H₉₈N₁₆O₂₂ C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 1419.55 g/mol 4963.5 g/mol
  • Purity ≥99%
  • CAS Number 137525-51-0 77591-33-4
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 20mg*10 vials

Product Description

BB20 (BPC-157 10mg + TB-500 10mg) is a lyophilized compound peptide product composed of two research peptides, BPC-157 and TB-500, in a 1:1 ratio. BPC-157 is a short-chain peptide consisting of 15 amino acids, while TB-500 is derived from a research fragment of Thymosin Beta-4; the two peptides have different molecular structures and research focuses. This compound system can be used to explore the interactions between different peptides, cell signaling regulation, tissue-related biological processes, and mechanisms related to regenerative medicine. The product is typically stored as a lyophilized powder and its quality is assessed using HPLC and LC-MS methods.

Full Specifications

  • Product Name BPC 10mg+TB 10mg
  • CAS Number 137525-51-0 77591-33-4
  • Molecular Formula C₆₂H₉₈N₁₆O₂₂ C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 1419.55 g/mol 4963.5 g/mol
  • Amino Acid Sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Purity (HPLC) ≥99%
  • Appearance White to off-white lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 20mg*10 vials
  • Quality Standards Conform

Research Applications

BPC-157 + TB-500 (BB20) is primarily used in basic life sciences and cell biology research, including studies on cell migration mechanisms, tissue microenvironment regulation, angiogenesis-related signals, inflammatory response mechanisms, and extracellular matrix-related research. Researchers use this composite peptide system to explore the mechanisms of action of short-chain peptides and protein fragments in the regulation of cell function, providing experimental references for peptide design and biomaterials research.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 5mg+TB 5mg

BPC 5mg+TB 5mgBB10

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of tw...

AUD$142.00 View Details →
TB-500(Thymosin β4 Acetate)

TB-500(Thymosin β4 Acetate)BT10

TB-500 (Thymosin β4 Acetate, BT10) is a thymosin β4-related research peptide u...

AUD$196.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us