Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » IGF-1 LR3
IGF-1 LR3
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

IGF-1 LR3

IG01
AUD$ 61.00
USD

IGF-1 LR3 (IG01) is a long-acting insulin-like growth factor-1 analog used for research on cell growth, signal transduction, and growth factor mechanisms.

Key Specifications

  • Molecular Formula C₃₃₁H₅₁₆N₉₀O₉₉S₇
  • Molecular Weight 9118.6 Da
  • Purity ≥99%
  • CAS Number 946870-92-4
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 0.1mg*10 vials

Product Description

IGF-1 LR3 (Long R3 IGF-1, IG01) is a structurally optimized insulin-like growth factor-1 (IGF-1) analog. This molecule improves the stability of native IGF-1 and alters its interaction characteristics with binding proteins through structural modification. IGF-1 LR3 is a growth factor research tool, typically supplied as a white to off-white lyophilized powder, and its quality is evaluated using HPLC, LC-MS, and protein analysis methods. This product is primarily used to study IGF-1 receptor-related signaling pathways, cell proliferation mechanisms, and growth factor regulation processes.

Full Specifications

  • Product Name IGF-1 LR3
  • CAS Number 946870-92-4
  • Molecular Formula C₃₃₁H₅₁₆N₉₀O₉₉S₇
  • Molecular Weight 9118.6 Da
  • Amino Acid Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPQKSQK
  • Purity (HPLC) ≥99%
  • Appearance White to off-white lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 0.1mg*10 vials
  • Quality Standards Conform

Research Applications

IGF-1 LR3 is primarily used in cell biology, molecular biology, and growth factor-related research. Researchers utilize IGF-1 LR3 to study IGF-1 receptor (IGF-1R)-mediated signal transduction, cell proliferation and differentiation mechanisms, protein-protein interactions, and growth factor regulatory networks. Furthermore, this research protein is also used to explore the biological roles of the IGF pathway in different cell models, providing experimental tools for basic life science research.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air


Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 5mg+TB 5mg

BPC 5mg+TB 5mgBB10

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of tw...

AUD$142.00 View Details →
BPC 10mg+TB 10mg

BPC 10mg+TB 10mgBB20

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product compose...

AUD$261.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us