Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Tirzepatide
Tirzepatide
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Tirzepatide

TR15
AUD$ 116.00
USD

Tirzepatide TR15 is a synthetic modified peptide research compound used to study metabolic regulation mechanisms, receptor effects, and peptide pharmacology via the GLP-1 and GIP dual receptor signaling pathways.

Key Specifications

  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Purity ≥99%
  • CAS Number 2023788-19-2
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 15mg/10mg vials

Product Description

Tirzepatide TR15 is a synthetic esterified peptide compound consisting of 39 amino acids, belonging to the GLP-1/GIP dual receptor agonist class. This molecule\'s research value is enhanced through structural optimization and fatty acid modification, enabling the exploration of the incretin receptor signaling pathway, cellular metabolic regulation mechanisms, and the structure-function relationship of multi-target peptide molecules. The product is supplied as a white to off-white lyophilized powder, and its quality is assessed by HPLC purity detection and LC-MS identification.

Full Specifications

  • Product Name Tirzepatide
  • CAS Number 2023788-19-2
  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Amino Acid Sequence YAEGTFTSDYSIYLDKQAQAFVQWLMNTKRNRNNIA
  • Purity (HPLC) ≥99%
  • Appearance White lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 12-24 months
  • Packaging 15mg/10mg vials
  • Quality Standards Conform

Research Applications

Tirzepatide TR15 is primarily used in metabolic biology, molecular pharmacology, and peptide engineering research, including studies of the GLP-1R/GIPR dual receptor signaling pathway, receptor binding mechanism analysis, cell signal transduction, glucose metabolism-related mechanisms, energy balance regulation, and the development of novel metabolic regulatory peptides. Researchers can utilize this compound to explore the synergistic effects of dual receptors and the regulatory mechanisms within complex metabolic networks.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Retatrutide

Retatrutide RT10

Retatrutide (RT10) is a synthetic peptide research compound designed as a triple...

AUD$116.00 View Details →
Retatrutide

Retatrutide RT20

Retatrutide (RT20) is a novel synthetic modified peptide, with the research code...

AUD$216.00 View Details →
Retatrutide

Retatrutide RT30

Retatrutide RT30 is a 30mg research-grade peptide product of Retatrutide (LY3437...

AUD$289.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us