Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Tirzepatide
Tirzepatide
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Tirzepatide

TR30
AUD$ 152.00
USD

Tirzepatide TR30 is a high-purity synthetic modified peptide research compound that is used for metabolic mechanisms, receptor interactions, and peptide pharmacology studies via the GLP-1 and GIP dual receptor signaling pathways.

Key Specifications

  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Purity ≥99%
  • CAS Number 2023788-19-2
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 30mg*10 vials

Product Description

Tirzepatide TR30 is a synthetic esterified peptide compound consisting of 39 amino acids, belonging to the GLP-1/GIP dual receptor agonist class. This molecule was designed using structural optimization and fatty acid modification to investigate incretin-related signaling pathways, receptor activation mechanisms, cellular metabolic regulation, and the structure-function relationships of multi-target peptides. TR30 is supplied as a white to off-white lyophilized powder and its quality was verified by analytical methods including HPLC purity detection and LC-MS identification.

Full Specifications

  • Product Name Tirzepatide
  • CAS Number 2023788-19-2
  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Amino Acid Sequence YAEGTFTSDYSIYLDKQAQAFVQWLMNTKRNRNNIA
  • Purity (HPLC) ≥99%
  • Appearance White lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 12-24 months
  • Packaging 30mg*10 vials
  • Quality Standards Conform

Research Applications

Tirzepatide TR30 is primarily used in metabolic biology, molecular pharmacology, and peptide engineering research, including studies on the GLP-1R/GIPR dual receptor signaling pathway, receptor binding mechanism analysis, cell signal transduction, glucose metabolism, energy balance regulation, lipid metabolism, and the development of novel metabolic regulatory peptides. This compound can be used to explore the synergistic effects of dual receptors and the regulatory mechanisms in complex metabolic networks.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Retatrutide

Retatrutide RT10

Retatrutide (RT10) is a synthetic peptide research compound designed as a triple...

AUD$116.00 View Details →
Retatrutide

Retatrutide RT20

Retatrutide (RT20) is a novel synthetic modified peptide, with the research code...

AUD$216.00 View Details →
Retatrutide

Retatrutide RT30

Retatrutide RT30 is a 30mg research-grade peptide product of Retatrutide (LY3437...

AUD$289.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us